PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587238.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 250aa    MW: 28717.7 Da    PI: 4.7722
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587238.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.6e-194395456
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     ++f++eq++ Le++Fe++ ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  XP_009587238.1 43 TRRFSDEQIKSLETMFENETKLEPRKKLQLARELGLQPRQVAIWFQNKRARWK 95
                    469*************************************************9 PP

2HD-ZIP_I/II122.62e-3942133293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     + rr+s+eq+k+LE++Fe+e+kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE+dy+ Lk+++d+l+++ ++L+ke+++L  +l++
  XP_009587238.1  42 NTRRFSDEQIKSLETMFENETKLEPRKKLQLARELGLQPRQVAIWFQNKRARWKSKQLERDYNILKSNFDHLASQYNSLKKENQSLLLQLQK 133
                     569***********************************************************************************999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.35E-192199IPR009057Homeodomain-like
PROSITE profilePS5007117.3133797IPR001356Homeobox domain
SMARTSM003891.8E-1640101IPR001356Homeobox domain
PfamPF000461.5E-164395IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-1943104IPR009057Homeodomain-like
CDDcd000861.98E-154498No hitNo description
PRINTSPR000311.0E-56877IPR000047Helix-turn-helix motif
PROSITE patternPS0002707295IPR017970Homeobox, conserved site
PRINTSPR000311.0E-57793IPR000047Helix-turn-helix motif
PfamPF021832.0E-1597139IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MFDGGEFSCT SSAAALNSAE CFSSSSFSSL PSSKKKKVNN KNTRRFSDEQ IKSLETMFEN  60
ETKLEPRKKL QLARELGLQP RQVAIWFQNK RARWKSKQLE RDYNILKSNF DHLASQYNSL  120
KKENQSLLLQ LQKLNDLMQK ERGQYCSIGF DQESYNRDDN TIKNKEMEGK PSLSFDLSEH  180
GVNGVISDDD SSIKADYFGL DEESDHLLKM VEAGDSSLTS PENWGSLEDD GLLDQQPNSS  240
NYDQWWDFWS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ8591550.0GQ859155.1 Nicotiana benthamiana HB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587238.10.0PREDICTED: homeobox-leucine zipper protein ATHB-12-like
SwissprotP468975e-70ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLD9I4C11e-157D9I4C1_NICAT; Homeodomain 20 transcription factor
STRINGPGSC0003DMT4000006941e-114(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20412363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.12e-59homeobox 7